PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4BL_F49830790.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 129aa    MW: 14741 Da    PI: 10.8633
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4BL_F49830790.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.47e-181461148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           rg+W+teEd +l + v+++G g+W+ I+r  g  R++k+c++rw++yl
  Traes_4BL_F49830790.1 14 RGPWSTEEDAKLMNHVAKHGLGRWSDIPRLAGIERCGKSCRLRWLNYL 61
                           89******************************66*************7 PP

2Myb_DNA-binding39.41.4e-1271109545
                            -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
        Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                            ++eE++l+++++   G+  W++Ia++++ gRt++ +k++w+
  Traes_4BL_F49830790.1  71 SQEEEDLIIQLHSIIGNS-WTLIAACLP-GRTDNGVKNFWN 109
                            89**************99.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.598965IPR017930Myb domain
SuperFamilySSF466899.17E-3112108IPR009057Homeodomain-like
SMARTSM007172.4E-131363IPR001005SANT/Myb domain
PfamPF002498.4E-171461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.3E-241568IPR009057Homeodomain-like
CDDcd001671.05E-101661No hitNo description
SMARTSM007172.0E-866114IPR001005SANT/Myb domain
PROSITE profilePS5129415.53366116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-2069116IPR009057Homeodomain-like
PfamPF002493.5E-1171109IPR001005SANT/Myb domain
CDDcd001674.73E-871109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 129 aa     Download sequence    Send to blast
MSKAPRGPRK AVRRGPWSTE EDAKLMNHVA KHGLGRWSDI PRLAGIERCG KSCRLRWLNY  60
LRPDLKRAAL SQEEEDLIIQ LHSIIGNSWT LIAACLPGRT DNGVKNFWNA SIKHKLRRRG  120
IDPDTHEPM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-311211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004958441.16e-65PREDICTED: myb-related protein Zm1-like
SwissprotQ8LPH64e-57MYB86_ARATH; Transcription factor MYB86
TrEMBLW5E8D92e-91W5E8D9_WHEAT; Uncharacterized protein
STRINGSi029872m4e-63(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.12e-58myb domain protein 86
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]